PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr001950.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family MYB
Protein Properties Length: 235aa    MW: 26867.1 Da    PI: 9.4692
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr001950.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.71.7e-15956148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT eEd +l d+++ +G+g W+++ +  g++R++k+c++rw +yl
      Pbr001950.1  9 KGLWTVEEDRILTDYIRVHGKGKWNRVNKVSGLKRSGKSCRLRWMNYL 56
                     678*******************************************97 PP

2Myb_DNA-binding57.92.2e-1862107148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r  +++eEd+l+++++++lG++ W++Ia +++ gRt++q+k++w+++l
      Pbr001950.1  62 RSDFSEEEDDLIIRLHNLLGNR-WSLIAGRVP-GRTDNQVKNHWNSHL 107
                      6789******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.362456IPR017930Myb domain
SuperFamilySSF466893.88E-307103IPR009057Homeodomain-like
SMARTSM007171.1E-12858IPR001005SANT/Myb domain
PfamPF002493.0E-13956IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-211063IPR009057Homeodomain-like
CDDcd001677.09E-101256No hitNo description
PROSITE profilePS5129427.65857111IPR017930Myb domain
SMARTSM007173.9E-1761109IPR001005SANT/Myb domain
PfamPF002494.9E-1762107IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.4E-2664111IPR009057Homeodomain-like
CDDcd001679.20E-1365107No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045165Biological Processcell fate commitment
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048765Biological Processroot hair cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MEGGNEYKKG LWTVEEDRIL TDYIRVHGKG KWNRVNKVSG LKRSGKSCRL RWMNYLSPSV  60
KRSDFSEEED DLIIRLHNLL GNRWSLIAGR VPGRTDNQVK NHWNSHLSKK LGVSSKRGKP  120
KAKTYSDSKR AKNNFCTPSS ESNSKLQPLP NSESNSKIFG DHEAAAAIDG FDDEMMNIQD  180
HSFSKGKVGF SGMWEATMVS NEKFWFHNDD LNLYSPYLRD PTLDDHYPFQ FDSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-2891117108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009363024.11e-175PREDICTED: transcription factor WER-like
SwissprotQ9SEI04e-65WER_ARATH; Transcription factor WER
TrEMBLM5WAK51e-123M5WAK5_PRUPE; Uncharacterized protein
STRINGVIT_17s0000g08480.t012e-75(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14750.13e-66myb domain protein 66